Home / Products / proteins / EIF1B, 1-113aa, Human, His tag, E.coli

EIF1B, 1-113aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
EIF1B is crucial for the scanning process in vitro. During the scanning process, EIF1B is a component of a complex involved in recognition of the initiator codon. Translation is also initiated by the role of EIF1B in regulating the activity of ribosomal subunits 43S, 48S and 40S. This protein enables 43S ribosomal complexes to discern between cognate and near-cognate initiation codons, sensing the nucleotide content of initiation codons.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01991
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.0 kDa (133aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSTIQNLQSFDPFADATKGDDLLPAGTEDYIHIRIQQRNGRKTLTTVQGIADDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLLEVGIVKEEQLKVHGF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol,2mM DTT, 0.1M NaCl.
Other Names Eukaryotic translation initiation factor 1B, GC20.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap