EGF, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Recombinant human epidermal growth factor (EGF) is a 6.3 kDa globular protein containing 54 amino acids residues, including 3 intra-molecular disulfide bonds. EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing. EGF signals through a receptor known as c-erbB, which is a class I tyrosine kinase receptor.
List Price: $307
  • Buy 5 for $291.65 each and save 5%
  • Buy 21 for $276.3 each and save 10%
  • Buy 31 for $260.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01984
Size 100 µg
Host E.coli
Accession
Molecular Weight 6.3kDa (54aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffered saline (pH 7.4)
Other Names Epidermal growth factor, Urogastrone
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap