Home / Products / proteins / EFNB1, 28-237aa, Human, His tag, E.coli

EFNB1, 28-237aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Ephrin-B1, also known as EFNB1, belongs to the Eph family. Ephrins, which act as ligands for Eph receptors, are cell-surface proteins that fall into two categories, ephrin-A and ephrin-B, based on their structure and function. EFNB1 proteins are transmembrane and have conserved cytoplasmic tyrosine residues that are phosphorylated upon interaction with an EphB receptor.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01979
Size 100 µg
Host E.coli
Accession
Molecular Weight 25.3 kDa (231aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKLDIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPNYMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSRPSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 5% glycerol
Other Names Ephrin-B1, CFND, CFNS, EFL3, Elk-L, EPLG2, LERK2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap