EEF1E1, 1-174aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
EEF1E1, also known as, eukaryotic translation elongation factor 1 epsilon-1, shares sequence similarity with the amino-terminal ends of the Beta and Gamma subunits of EF-1. By specifically interacting with MetRS, this protein binds to a macromolecular tRNA synthtase complex that catalyzes the ligation of specific amino acids to their cognate tRNAs.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01972
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.9 kDa (194aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl,1mM DTT
Other Names Eukaryotic translation elongation factor 1 epsilon-1, AIMP3, P18.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap