Home / Products / proteins / DYNLT3, 1-116aa, Human, His tag, E.coli

DYNLT3, 1-116aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DYNLT3 is a member of a subclass of dynein light chains. This protein homodimerizes and forms the light chain component of the cytoplasmic dynein motor protein complex. It may be important for binding dynein to specific cargos including the spindle checkpoint protein BUB3. DYNLT3 may also function independently of dynein as a transcriptional modulator.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01949
Size 50 µg
Host E.coli
Accession
Molecular Weight 15.5 kDa (139aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMEEYHRHCDEVGFNAEEAHNIVKECVDGVLGGEDYNHNNINQWTASIVEQSLTHLVKLGKAYKYIVTCAVVQKSAYGFHTASSCFWDTTSDGTCTVRWENRTMNCIVNVFAIAIVL
Purity > 95% by HPLC
Concentration 0.25 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol
Other Names Dynein light chain Tctex-type 3, RP3; TCTE1L; TCTEX1L.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap