Home / Products / proteins / DYNLRB1, 1-96aa, Human, His tag, E.coli

DYNLRB1, 1-96aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Dynein light chain roadblock-type, also known as DYNLRB1 is a member of the roadblock dynein light chain family and encodes a cytoplasmic protein that is capable of binding intermediate chain proteins. Upregulation of this gene has been associated with hepatocellular carcinomas, suggesting that this gene may be involved in tumor progression.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01946
Size 50 µg
Host E.coli
Accession
Molecular Weight 11.9 kDa (104aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MAEVEETLKRLQSQKGVQGIIVVNTEGIPIKSTMDNPTTTQYASLMHSFILKARSTVRDIDPQNDLTFLRIRSKKNEIMVAPDKDYFLIVIQNPTELEHHHHHH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing, 10% glycerol
Other Names Dynein light chain roadblock-type1, BITH, BLP, DNCL2A, DNLC2A, ROBLD1, HSPC162
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap