Home / Products / proteins / DYNLL1, 1-89aa, Human, His tag, E.coli

DYNLL1, 1-89aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DYNLL1, also known as DLC8 or PIN (protein inhibitor of neuronal nitric oxide synthase), has been identified as a protein that interacts with NOS1 resulting in NOS1 inhibition. Binding of this protein destabilizes NOS1(Neuronal nitric oxide synthase) dimer, a conformation necessary for activity, and it may regulate numerous biologic processes through its effects on nitric oxide synthase activity.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01944
Size 100 µg
Host E.coli
Accession
Molecular Weight 12.5 kDa (109aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl,1mM DTT, 10% glycerol
Other Names Dynein light chain 1, cytoplasmic, DLC1, DLC8, DNCL1, DNCLC1, hdlc1, LC8, LC8a, MGC126137, MGC126138, PIN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap