Home / Products / proteins / Disulfide-bond isomerase (DsbC) E.coli, Recombinant

Disulfide-bond isomerase (DsbC) E.coli, Recombinant

Categories: [Proteins / Peptides]
Dsb proteins (DsbA, DsbB, DsbC, and DsbD) catalyze formation and isomerization of protein disulfide bonds in the periplasm of Escherichia coli. DsbC is periplasmic enzyme known as a disulfide isomerase and can convert aberrant disulfide bonds to correct ones. DsbC consists of 236 amino acids containing signal peptide (1-20 amino acids). RecombinantDsbCwas expressed inE. coli andpurified byusing conventional chromatography techniques.
List Price: $248
  • Buy 5 for $235.6 each and save 5%
  • Buy 21 for $223.2 each and save 10%
  • Buy 31 for $210.8 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01882
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.4kDa (216aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTAPVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALGITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHYVLGVQLGVSGTPAVVLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Hepesl buffer (pH 7.5) containing 2 mM EDTA
Other Names Disulfide-bond isomerase C, Thiol:disulfide interchange protein dsbC, xprA
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap