Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01873 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 22.0kDa (197aa) |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMCGPGRGPVGRRRYARKQLVPLLYKQFVPGVPERTLGASGPAEGRVARGSERFRDLVPNYNPDIIFKDEENSGADRLMTERCKERVNALAIAVMNMWPGVRLRVTEGWDEDGHHAQDSLHYEGRALDITTSDRDRNKYGLLARLAVEAGFDWVYYESRNHVHVSVKADNSLAVRAGG |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml |
Formulation | Liquid in 20mM MES pH 5.5, 0.5mM DTT, 20% glycerol |
Other Names | desert hedgehog preproprotein, Drosophila, HHG-3, MGC35145, Desert hedgehog protein N-product |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap