deoC, 1-259 aa

Categories: [Proteins / Peptides]
DeoC is a member of the deoC/fbaB aldolase protein family. The systematic name of this enzyme class is 2-deoxyribose-5-phosphate aldolase, which cleave carbon-carbon bonds. This protein is Involved in the carbohydrate degradation pathway, catalyzes the conversion of 2-deoxy-D-ribose 5-phosphate to D-glyceraldehyde 3-phosphate and an acetyldehyde. Recombinant E.coli deoC protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01864
Size 100 µg
Host
Accession
Molecular Weight 29.9 kDa (279aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMTDLKASSLRALKLMDLTTLNDDDTDEKVIALCHQAKTPVGNTAAICIYPRFIPIARKTLKEQGTPEIRIATVTNFPHGNDDIDIALAETRAAIAYGADEVDVVFPYRALMAGNEQVGFDLVKACKEACAAANVLLKVIIETGELKDEALIRKASEISIKAGADFIKTSTGKVAVNATPESARIMMEVIRDMGVEKTVGFKPAGGVRTAEDAQKYLAIADELFGADWADARHYRFGASSLLASLLKALGHGDGKSASSY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol 2mM DTT.
Other Names dra, ECK4373, JW4344, thyR, DERA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap