Home / Products / proteins / DCTD, 1-178aa, Human, His tag, E.coli

DCTD, 1-178aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
DCTD (deoxycytidylate deaminase), also known as dCMP deaminase, is a 178 amino acid allosteric enzyme that exists as a homohexamer and belongs to the cytidine and deoxycytidylate deaminase protein family. Using zinc as a cofactor, DCTD catalyzes the deamination of dCMP to dUMP, thereby producing the nucleotide substrate (dUMP) that is used by thymidylate synthase.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01840
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.1 kDa (198aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSEVSCKKRDDYLEWPEYFMAVAFLSAQRSKDPNSQVGACIVNSENKIVGIGYNGMPNGCSDDVLPWRRTAENKLDTKYPYVCHAELNAIMNKNSTDVKGCSMYVALFPCNECAKLIIQAGIKEVIFMSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKLQ
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.1M NaCl,1mM DTT, 20% glycerol
Other Names Deoxycytidylate deaminase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap