CXCL3, 28-100aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
CXCL3/GROg is a small cytokine belonging to the CXC chemokine family. CXCL3 controls migration and adhesion of monocytes and mediates it effects on its target cell by interacting with a cell surface chemokine receptor called CXCR2. Recombinant mouse CXCL3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01799
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.6kDa(98aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAVVASELRCQCLNTLPRVDFETIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQGPRLQIIIKKILKSGKSS
Purity > 95% by HPLC
Concentration 0.25 mg/ml
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 50% glycerol 0.15M NaCl,5mM DTT
Other Names Chemokine (C-X-C motif) ligand 3, Dcip1, Gm1960.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap