Cxcl12, 22-89aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Cxcl12 also known as stromal cell-derived factor 1 isoform alpha. This protein acts as a positive regulator of monocyte migration and a negative regulator of monocyte adhesion via the LYN kinase. It stimulates migration of monocytes and T-lymphocytes through its receptors, CXCR4 and ACKR3, and decreases monocyte adherence to surfaces coated with ICAM-1, a ligand for beta-2 integrins. This protein inhibits CXCR4-mediated infection by T-cell line-adapted HIV-1. Cxcl12 protein plays a protective role after myocardial infarction. It induces down-regulation and internalization of ACKR3 expressed in various cells. Recombinant mouse Cxcl12, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $275
  • Buy 5 for $261.25 each and save 5%
  • Buy 21 for $247.5 each and save 10%
  • Buy 31 for $233.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01795
Size 20 µg
Host E.coli
Accession
Molecular Weight 10.4kDa (91aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSKPVSLSYRCPCRFFESHIARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNK
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH7.4) containing 10% glycerol
Other Names Pbsf, Scyb12, Sdf1, Tlsf, Tpar1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap