Home / Products / proteins / CXCL11, 22-94aa, Human, His tag, E.coli

CXCL11, 22-94aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Chemokine (C-X-C motif) ligand 11 (CXCL11) is a small cytokine belonging to the CXC chemokine family that is also called Interferon-inducible T-cell alpha chemoattractant (I-TAC) and Interferon-gamma-inducible protein 9 (IP-9). CXCL11 is strongly induced by IFN-γ and IFN-β, and weakly induced by IFN-α. It is chemotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01794
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.6kDa (94aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM sodium citrate(pH 3.5), 20% glycerol, 2mM DTT
Other Names C-X-C motif chemokine 11, b-R1, H174, I-TAC, IP-9, IP9, MGC102770, SCYB11, SCYB9B.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap