Home / Products / proteins / CXCL1/GROα, 35-107aa, Human, His-Tagged, Recombinant, E.coli

CXCL1/GROα, 35-107aa, Human, His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CXCL1/GROa is a growth factor for melanoma cells and a chemotaxin for neutrophils. Similar to other alpha chemokines, this protein is potent neutrophil attractant and activator and is also active toward basophils. In addition, CXCL1 protein may be a therapeutic target as well as a diagnostic marker in ovarian cancer. Recombinant CXCL1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01793
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.1 kDa (94 aa), confirmed by MALDI-TOF. (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Chemokine (C-X-C motif) ligand 1 / Growth-regulated alpha protein, FSP, GRO1, GROA, MGSA, NAP-3, SCYB1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap