CSTA, 1-98aa, Human, His tag, E.coli (Bioactivity Validated)

Categories: [Proteins / Peptides]
CSTA, also known as Stefin A, is thiol protease inhibitors that form complexes with papain and the cathepsins B, H and L. The protein is one of the precursor proteins of the cornified cell envelope in keratinocytes and plays a role in epidermal development and maintenance. CSTA is thought to be a tumor suppressor, since an inverse correlation seems to exist between the level of CSTA and tumor progression, in several malignancies Recombinant human CSTA protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $135
  • Buy 5 for $128.25 each and save 5%
  • Buy 21 for $121.5 each and save 10%
  • Buy 31 for $114.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01757
Size 20 µg
Host E.coli
Accession
Molecular Weight 13.1 kDa (118aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRAGDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names Cystatin-A, STF1, STFA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap