CST7, 20-1452aa, Human, His tag, Insect cell

Categories: [Proteins / Peptides]
CST7, also known as cystatin-F, contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. This gene encodes a glycosylated cysteine protease inhibitor with a putative role in immune regulation through inhibition of a unique target in the hematopoietic system. Expression of the protein has been observed in various human cancer cell lines established from malignant tumors. Recombinant human CST7, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01754
Size 50 µg
Host Insect cell
Accession
Molecular Weight 15.3kDa (132aa) (18-28kDa in SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences GPSPDTCSQDLNSRVKPGFPKTIKTNDPGVLQAARYSVEKFNNCTNDMFLFKESRITRALVQIVKGLKYMLEVEIGRTTCKKNQHLRLDDCDFQTNHTLKQTLSCYSEVWVVPWLQHFEVPVLRCHHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by absorbance at 280nm)
Formulation Liquid. In phosphate buffered saline (pH7.4).
Other Names Cystatin F, CMAP
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap