CLPP, 57-277aa, Human, E.coli

Categories: [Proteins / Peptides]
CLPP (ATP-dependent Clp protease proteolytic subunit) belongs to the peptidase family S14. CLPP cleaves peptides in various proteins in a process that requires ATP hydrolysis. CLPP, the catalytic core of the Clp proteolytic complex, is widely involved in many cellular processes via the regulation of intracellular protein quality.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01649
Size 50 µg
Host E.coli
Accession
Molecular Weight 24.2kDa (222aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MPLIPIVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYINSPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQPSGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGILDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 2mM DTT, 20% glycerol, 100mM NaCl
Other Names Putative ATP-dependent Clp protease proteolytic subunit, mitochondrial, Endopeptidase Clp
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap