Home / Products / proteins / CENPH, 136-247aa, Human, His tag, E.coli

CENPH, 136-247aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CENPH, also known as centromere protein H, belongs to the centromere protein H family. This protein is component of the CENPA-NAC (nucleosome-associated) complex that plays a central role in assembly of kinetochore proteins. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01578
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.5 kDa (133aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMLNKLIMKSQQESWDLEEKLLDIRKKRLQLKQASESKLLEIQTEKNKQKIDLDSMENSERIKIIRQNLQMEIKITTVIQHVFQNLILGSKVNWAEDPALKEIVLQLEKNVDMM
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by UV spectroscopy at 280 nm)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names Centromere protein H.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap