CEACAM3, 35-155aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Carcinoembryonic antigen-related cell adhesion molecule 3 isoform 2, also known as CEACAM3, belongs to the immunoglobulin superfamily of genes encode cell adhesion proteins, which are expressed at higher levels in tumorous tissues than in normal tissues. CEACAM3 plays an important role in the clearance of pathogens by the innate immune system. It is responsible for RAC1 stimulation in the course of pathogen phagocytosis. Recombinant human CEACAM3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $414
  • Buy 5 for $393.3 each and save 5%
  • Buy 21 for $372.6 each and save 10%
  • Buy 31 for $351.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01570
Size 50 µg
Host E.coli
Accession
Molecular Weight 15.5 kDa (144aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSKLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAG
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 20% glycerol
Other Names Carcinoembryonic antigen-related cell adhesion molecule 3 isoform 2, CD66D, CEA, CGM1, W264, W282
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap