CD80, 37-246aa, Mouse, His tag, Baculovirus

Categories: [Proteins / Peptides]
Cd80, also known as T-lymphocyte activation antigen CD80, is a member of cell surface immunoglobulin superfamily and is expressed on the surface of antigen-presenting cells including activated B cells, macrophages and dendritic cells. It is the ligand for two different proteins on the T cell surface: Cd28 (for autoregulation and intercellular association) and Ctla4 (for attenuation of regulation and cellular disassociation). This protein also plays a role in induction of innate immune responses by activating NF-KB-signaling pathway in macrophages. It is thus regarded as promising therapeutic targets for autoimmune diseases and various carcinomas. Recombinant mouse Cd80, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $357
  • Buy 5 for $339.15 each and save 5%
  • Buy 21 for $321.3 each and save 10%
  • Buy 31 for $303.45 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01536
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 24.7kDa (216aa); 28-40KDa (SDS-PAGE under non-reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences DVDEQLSKSVKDKVLLPCRYNSPHEDESEDRIYWQKHDKVVLSVIAGKLKVWPEYKNRTLYDNTTYSLIILGLVLSDRGTYSCVVQKKERGTYEVKHLALVKLSIKADFSTPNITESGNPSADTKRITCFASGGFPKPRFSWLENGRELPGINTTISQDPESELYTISSQLDFNTTRNHTIKCLIKYGDAHVSEDFTWEKPPEDPPDSKNHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names T-lymphocyte activation antigen CD80, Cd80, Cd28l, Ly-53, Ly53, MIC17, TSA1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap