Home / Products / proteins / CCL4L1, 24-92aa, Human, His tag, E.coli

CCL4L1, 24-92aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL4L1 (C-C motif chemokine 4-like) belongs to intercrine beta (chemokine CC) family. This protein is similar to CCL4 which inhibits HIV replication in peripheral blood monocytes that express CCR5. Recombinant human CCL4L1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01468
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.5kDa (94aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM sodium citrate (pH 3.5), 10% glycerol
Other Names C-C motif chemokine 4-like, AT744.2, CCL4L, CCL4L2, LAG-1, LAG1, SCYA4L
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap