Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01468 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 10.5kDa (94aa) confirmed by MALDI-TOF (Molecular weight on SDS-PAGE will appear higher) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSHMAPMGSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN |
Purity | > 95% by HPLC |
Concentration | 0.5mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 10mM sodium citrate (pH 3.5), 10% glycerol |
Other Names | C-C motif chemokine 4-like, AT744.2, CCL4L, CCL4L2, LAG-1, LAG1, SCYA4L |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap