Home / Products / proteins / CCL3L1, 26-93aa, Human, His tag, E.coli

CCL3L1, 26-93aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL3L1 is a small cytokine belonging to the CC chemokine. This protein is involved in immunoregulatory and inflammatory processes. It binds to several chemokine receptors including chemokine binding protein 2 (CCBP2 or D6) and chemokine (C-C motif) receptor 5 (CCR5).
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01467
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.0 kDa (90aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPSVIFLTKRGRQVCADPSEEWVQKYVSDLELSA
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline pH7.4 containing 10% glycerol
Other Names C-C motif chemokine 3-like 1, CCL3L3, D17S1718, G0S19-2, LD78, LD78BETA, MIP1AP, SCYA3L; SCYA3L1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap