Home / Products / proteins / CCL3, 24-92aa, Mouse, His tag, E.coli

CCL3, 24-92aa, Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
C-C motif chemokine 3, also known as CCL3, belongs to the intercrine beta (chemokine CC) family. CCL3 has a potent chemotactic activity for eosinophils. This protein is binding to a high-affinity receptor activates calcium release in neutrophils.
List Price: $383
  • Buy 5 for $363.85 each and save 5%
  • Buy 21 for $344.7 each and save 10%
  • Buy 31 for $325.55 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01466
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.4 kDa (93aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAPYGADTPTACCFSYSRKIPRQFIVDYFETSSLCSQPGVIFLTKRNRQICADSKETWVQEYITDLELNA
Purity > 95% by HPLC
Concentration 0.5 mg/ml
Formulation Liquid. In 20mM Sodium citrate buffer (pH 3.5) containing 10% glycerol
Other Names C-C motif chemokine 3, AI323804, G0S19-1, LD78alpha, MIP-1alpha, MIP1-(a), MIP1-alpha, Mip1a, Scya3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap