Home / Products / proteins / CCL3, 24-92aa, Human, His tag, E.coli

CCL3, 24-92aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL3, also known as, macrophage inflammatory protein-1alpha (MIP-1alpha), is a cytokine belonging to the CC chemokine family that is involved in the acute inflammatory state in the recruitment and activation of polymorphonuclear leukocytes.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01465
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.0 kDa (90aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM Sodium Citrate ( pH3.5) containing 10% glycerol
Other Names C-C motif chemokine 3, G0S19-1, LD78ALPHA. MIP-1-alpha. MIP1A. SCYA3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap