Home / Products / proteins / CCL28, 23-127 aa, Human, His-tagged, Recombinant, E.coli

CCL28, 23-127 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CCL28, also known as chemokine (C-C motif) ligand 28 or mucosae-associated epithelial chemokine(MEC), belongs to the subfamily of small cytokine CC proteins. CCL28 is expressed by columnar epithelial cells in the gut, lung, breast and the salivary glands and drives the mucosal homing of T and B lymphocytes that express CCR10, and the migration of eosinophils expressing CCR3.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01464
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.3 kDa (126aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM Sodium Citrate pH3.5 containing 10% Glycerol
Other Names Chemokine (C-C motif) ligand 28, CCK1, MEC, SCYA28
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap