Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01464 |
Size | 100 µg |
Host | E.coli |
Accession | |
Molecular Weight | 14.3 kDa (126aa) |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMILPIASSCCTEVSHHISRRLLERVNMCRIQRADGDCDLAAVILHVKRRRICVSPHNHTVKQWMKVQAAKKNGKGNVCHRKKHHGKRNSNRAHQGKHETYGHKTPY |
Purity | > 95% by HPLC |
Concentration | 1 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 10mM Sodium Citrate pH3.5 containing 10% Glycerol |
Other Names | Chemokine (C-C motif) ligand 28, CCK1, MEC, SCYA28 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap