Home / Products / proteins / CCL27, 25-112aa, Human, E.coli

CCL27, 25-112aa, Human, E.coli

Categories: [Proteins / Peptides]
Cutaneous T cell-attracting chemokine CCL27 is a member of the chemokine superfamily and the subfamily of β r C-C chemokines that binds chemokine receptor CCR10. Chemokines are a superfamily of small secreted proteins that attract their targets by interacting with G protein-coupled receptors expressed on the migrating cell.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01463
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.3 kDa (89aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MFLLPPSTACCTQLYRKPLSDKLLRKVIQVELQEADGDCHLQAFVLHLAQRSICIHPQNPSLSQWFEHQERKLHGTLPKLNFGMLRKMG
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10 mM Sodium Citrate (pH 3.5), containing 10% Glycerol.
Other Names C-C motif chemokine 27, ALP, CTACK, CTAK, ESKINE, ILC, PESKY, SCYA27
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap