CCL25 24-150aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL25 also known as C-C motif chemokine 25 isoform 1. CCL25 is potentially involved in T-cell development. Recombinant protein shows chemotactic activity on thymocytes, macrophages, THP-1 cells, and dendritics cells but is inactive on peripheral blood lymphocytes and neutrophils. It binds to CCR9. Isoform 2 is an antagonist of isoform1 and binds to atypical chemokine receptor ACKR4 and mediates the recruitment of beta-arrestin (ARRB1/2) to ACKR4. Recombinant human CCL25-iso1, fused to His-tag at N-terminus, was expressed in E.coli .
List Price: $213
  • Buy 5 for $202.35 each and save 5%
  • Buy 21 for $191.7 each and save 10%
  • Buy 31 for $181.05 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01461
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.8kDa (152aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMQGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names C-C motif chemokine 25 isoform 1, Ckb15, SCYA25, TECK
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap