Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01459 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 14.5 kDa (132aa) |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP |
Purity | > 95% by HPLC |
Concentration | 0.5 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycero 1mM DTT.l |
Other Names | C-C motif chemokine 21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4. |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap