Home / Products / proteins / CCL21, 24-134aa, Human, His tag, E.coli

CCL21, 24-134aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL21 is member of the chemokine superfamily and the subfamily of CC chemokines that has an aspartatecysteine-cysteine-leucine motif near its amino-terminus. This protein is involved in inhibits hemopoiesis and stimulates chemotaxis. CCL21 is chemotactic in vitro for thymocytes and activated T-cells, but not for B-cells, macrophages, or neutrophils.
List Price: $275
  • Buy 5 for $261.25 each and save 5%
  • Buy 21 for $247.5 each and save 10%
  • Buy 31 for $233.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01459
Size 50 µg
Host E.coli
Accession
Molecular Weight 14.5 kDa (132aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris buffer(pH 8.0) containing 10% glycero 1mM DTT.l
Other Names C-C motif chemokine 21, 6Ckine, CKb9, ECL, SCYA21, SLC, TCA4.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap