Home / Products / proteins / CCL20, 27-96aa, Human, His tag, E.coli

CCL20, 27-96aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL20, also known as Macrophage Inflammatory Protein-3 (MIP3A), is a small cytokine belonging to the CC chemokine family. CCL20 protein is strongly chemotactic for lymphocytes and weakly attracts neutrophils. It is implicated in the formation and function of mucosal lymphoid tissues via chemoattraction of lymphocytes and dendritic cells towards the epithelial cells surrounding these tissues.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01458
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.3 kDa (91aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline pH7.4 containing 10% glycerol
Other Names C-C motif chemokine 20, CKb4, LARC, MIP-3a, MIP3A, SCYA20, ST38
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap