Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01457 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 16 kDa (146aa) confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCPKEAVVFVTKLKREVCADPKKEWVQTYIKNLDRNQMRSEPTTLFKTASALRSSAPLNVKLTRKSEANASTTFSTTTSSTSVGVTSVTVN |
Purity | > 95% by HPLC |
Concentration | 0.25 mg/ml (determined by Bradford assay) |
Formulation | Liquid. In PBS (pH 7.4) containing 10% glycerol. |
Other Names | C-C motif chemokine 2, AI323594, HC11, JE, MCAF, MCP-1, MCP1, Scya2, Sigje, SMC-CF |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap