Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01455 |
Size | 10 μg |
Host | E.coli |
Accession | |
Molecular Weight | 10.4 kDa (93aa), confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | N-6His |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSHMQVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA |
Purity | > 95% by HPLC |
Concentration | 0.25 mg/ml (determined by BCA assay) |
Formulation | Liquid. In 10mM Sodium Citrate pH3.5, 10% Glycerol |
Other Names | C-C motif chemokine 18, AMAC-1, AMAC1, CKb7, DC-CK1, DCCK1, MIP-4, PARC, SCYA18 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap