Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01454 |
Size | 50 µg |
Host | E.coli |
Accession | |
Molecular Weight | 10.3 kDa (92aa) |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS |
Purity | > 95% by HPLC |
Concentration | > 95% by SDS - PAGE |
Formulation | Liquid. In Phosphate Buffered Saline (pH7.4) containing 10% glycerol |
Other Names | Chemokine (C-C motif) ligand 17, A-152E5.3, ABCD-2, SCYA17, TARC |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap