Home / Products / proteins / CCL17, 24-94 aa, Human, His-tagged, Recombinant, E.coli

CCL17, 24-94 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
CCL17 is a small cytokine belonging to the CC chemokine family that is also known as thymus and activation regulated chemokine (TARC). This protein is involved in immunoregulatory and inflammatory processes. It is expressed constitutively in thymus, but only transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01454
Size 50 µg
Host E.coli
Accession
Molecular Weight 10.3 kDa (92aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
Purity > 95% by HPLC
Concentration > 95% by SDS - PAGE
Formulation Liquid. In Phosphate Buffered Saline (pH7.4) containing 10% glycerol
Other Names Chemokine (C-C motif) ligand 17, A-152E5.3, ABCD-2, SCYA17, TARC
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap