CCL15, 22-113aa, Human, E.coli

Categories: [Proteins / Peptides]
Chemokine (C-C motif) ligand 15, also known as CCL15, is a small cytokine belonging to the CC chemokine family that is also known as thymus and activation regulated chemokine. CCL15 induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor.
List Price: $167
  • Buy 5 for $158.65 each and save 5%
  • Buy 21 for $150.3 each and save 10%
  • Buy 31 for $141.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01453
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.3kDa (93aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffered saline (pH7.4), 10% glycerol
Other Names Chemokine (C-C motif) ligand 15, HCC-2, HMRP-2B, Lkn-1, LKN1, MIP-1d, MIP-5NCC-3, NCC3, SCYA15, SCYL3, SY15
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap