Home / Products / proteins / CCL14, 20-93aa, Human, His tag, E.coli

CCL14, 20-93aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
CCL14, also known as Chemokine (C-C motif) ligand 14, is member of a superfamily of inducible, secreted, proinflammatory cytokines. It has weak activities on human monocytes and acts via receptors that also recognize MIP-1α. It also enhances the proliferation of CD34 myeloid progenitor cells.
List Price: $244
  • Buy 5 for $231.8 each and save 5%
  • Buy 21 for $219.6 each and save 10%
  • Buy 31 for $207.4 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01452
Size 100 µg
Host E.coli
Accession
Molecular Weight 10.9 kDa (95aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMTKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate Buffered Saline pH7.4 containing 10% glycerol
Other Names C-C motif chemokine 14, CC-1, CC-3, CKb1, FLJ16015, HCC-1, HCC-3, MCIF, NCC-2, NCC2, SCYA14, SCYL2, SY14
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap