Cathepsin E, 21-397aa, Mouse, His tag, Insect cell

Categories: [Proteins / Peptides]
CTSE, also known as cathepsin E, belongs to an intracellular aspartic protease of the pepsin family. It plays an important role in the degradation of proteins, the generation of bioactive proteins, and antigen processing. It is efficient in cleaving the Swedish mutant of amyloid precursor protein (APP) at the B site but show almost on reactivity with the wild-type APP. Recombinant mouse CTSE, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01435
Size 50 µg
Host Insect cell
Accession
Molecular Weight 41.8kDa (385aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag N-6His
Sequences ALHRVPLRRHQSLRKKLRAQGQLSEFWRSHNLDMTRLSESCNVYSSVNEPLINYLDMEYFGTISIGTPPQNFTVIFDTGSSNLWVPSVYCTSPACKAHPVFHPSQSDTYTEVGNHFSIQYGTGSLTGIIGADQVSVEGLTVDGQQFGESVKEPGQTFVNAEFDGILGLGYPSLAAGGVTPVFDNMMAQNLVALPMFSVYLSSDPQGGSGSELTFGGYDPSHFSGSLNWIPVTKQAYWQIALDGIQVGDTVMFCSEGCQAIVDTGTSLITGPPDKIKQLQEAIGATPIDGEYAVDCATLDTMPNVTFLINEVSYTLNPTDYILPDLVEGMQFCGSGFQGLDIPPPAGPLWILGDVFIRQFYSVFDRGNNQVGLAPAVPLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names CTSE, A430072003Rik, C920004C08Rik, CatE, CE
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap