Carbonic Anhydrase, 1-220aa, E.coli, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Carbonic anhydrase (CA) is an enzyme that catalyses rapid conversion of carbon dioxide to bicarbonate and protons (CO2 + H2O ↔ HCO3 − + H+). Most carbonic anhydrases contain a zinc ion in their active site and the primary function of this enzyme is known to maintain acid-base balance in blood and other tissues, and to help transport carbon dioxide of tissues.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01427
Size 100 µg
Host E.coli
Accession
Molecular Weight 27kDa (240aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSVVQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGHSTIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1 mM DTT, 10% glycerol.
Other Names Carbonate dehydratase, CAN, yadF
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap