Carbonic anhydrase 1, 1-261 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Carbonic anhydrase (CA) is an enzyme that catalyses rapid conversion of carbon dioxide to bicarbonate and protons (CO2 + H2O HCO3- + H+). Most carbonic anhydrases contain a zinc ion in their active site and the primary function of this enzyme is known to maintain acid-base balance in blood and other tissues, and to help transport carbon dioxide of tissues. Carbonic anhydrases have been found in all kingdoms of life. Recombinant carbonic anhydrase fused to His-tag, was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $131
  • Buy 5 for $124.45 each and save 5%
  • Buy 21 for $117.9 each and save 10%
  • Buy 31 for $111.35 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01423
Size 20 µg
Host E.coli
Accession
Molecular Weight 31.0 kDa (281aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVSYNPATAKEIINVGHSFHVNFEDNDNRSVLKGGPFSDSYRLFQFHFHWGSTNEHGSEHTVDGVKYSAELHVAHWNSAKYSSLAEAASKADGLAVIGVLMKVGEANPKLQKVLDALQAIKTKGKRAPFTNFDPSTLLPSSLDFWTYPGSLTHPPLYESVTWIICKESISVSSEQLAQFRSLLSNVEGDNAVPMQHNNRPTQPLKGRTVRASF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 1mM DTT, 10% glycerol
Other Names CA1, CA-I, CAB
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap