CAMK2N2, 1-79aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Calcium/calmodulin-dependent protein kinase II, also known as CAMK2N2, is potent and specific cellular inhibitor of CaM-kinase II (CAMK2). This protein may play an important role in the regulation of cell growth when overexpressed in colon adenocarcinoma LoVo cells. Recombinant human CAMK2N2 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01414
Size 100 µg
Host E.coli
Accession
Molecular Weight 11.0 kDa (102aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKGMGEKPPSGV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol, 1mM DTT
Other Names Calcium/calmodulin-dependent protein kinase II, CAM-KIIN, CAMKIIN
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap