Data Sheet | Click for Datasheet |
---|---|
Catalog Number | TP01413 |
Size | 10 µg |
Host | E.coli |
Accession | |
Molecular Weight | 10.9 kDa (101aa) Confirmed by MALDI-TOF |
AP_Mol_Weight | |
Tag | |
Sequences | MGSSHHHHHHSSGLVPRGSHMGSMSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV |
Purity | > 95% by HPLC |
Concentration | 0.5mg/ml (determined by BCA Assay) |
Formulation | Liquid. In 20mM Tris-HCl (pH8.5) containing 1mM DTT, 0.1M NaCl, 10% glycerol |
Other Names | Calcium/calmodulin-dependent protein kinase II inhibitor 1, 1810006K23Rik, AI848599, AI89176 |
Bioactivity | |
Storage | Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles. |
Postscript | For research use only, not for use in diagnostic procedures. |
© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap