Camk2n1, 1-78aa, Mouse, His-tag, E.coli

Categories: [Proteins / Peptides]
Camk2n1, also known as Calcium/calmodulin-dependent protein kinase II inhibitor 1, belongs to the CAMK2N family. This protein interacts with CAMK2B; the presence of Ca2+/calmodulin increases the interaction but is not essential. It also interacts with CAMK2A; this interaction requires CAMK2A activation by Ca2+. Camk2n1 is potent and specific inhibitor of CaM-kinase II (CAMK2). Recombinant mouse Camk2n1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $276
  • Buy 5 for $262.2 each and save 5%
  • Buy 21 for $248.4 each and save 10%
  • Buy 31 for $234.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01413
Size 10 µg
Host E.coli
Accession
Molecular Weight 10.9 kDa (101aa) Confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSEVLPYGDEKLSPYGDGGDVGQIFSCRLQDTNNFFGAGQSKRPPKLGQIGRSKRVVIEDDRIDDVLKTMTDKAPPGV
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by BCA Assay)
Formulation Liquid. In 20mM Tris-HCl (pH8.5) containing 1mM DTT, 0.1M NaCl, 10% glycerol
Other Names Calcium/calmodulin-dependent protein kinase II inhibitor 1, 1810006K23Rik, AI848599, AI89176
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap