Home / Products / proteins / CALR3, 20-384aa Human, His tag, E.coli

CALR3, 20-384aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Calreticulin 3, also known as CALR3, is a member of the calreticulin (CRT) family. It is calcium-binding chaperones that are localized to the endoplasmic reticulum or sarcoplasmic reticulum in eukaryotes. CALR3 assists in the calreticulin/calnexin cycle, where it is involved in protein-folding, oligomeric assembly and quality control in the ER. With specific expression in testis, CALR3 has been implicated as a cancer-testis antigen due to its frequent expression in various cancers. Recombinant human CALR3 protein was expressed in E.coli.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01409
Size 100 µg
Host E.coli
Accession
Molecular Weight 43 kDa (366aa)
AP_Mol_Weight
Tag N-6His
Sequences MTVYFQEEFLDGEHWRNRWLQSTNDSRFGHFRLSSGKFYGHKEKDKGLQTTQNGRFYAISARFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKVFPADIDQKNLNGKSQYYIMFGPDICGFDIKKVHVILHFKNKYHENKKLIRCKVDGFTHLYTLILRPDLSYDVKIDGQSIESGSIEYDWNLTSLKKETSPAESKDWEQTKDNKAQDWEKHFLDASTSKQSDWNGDLDGDWPAPMLQKPPYQDGLKPEGIHKDVWLHRKMKNTDYLTQYDLSEFENIGAIGLELWQVRSGTIFDNFLITDDEEYADNFGKATWGETKGPEREMDAIQAKEEMKKAREEEEEELLSGKINRHEHYFNQFHRRNEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.4M Urea, 10% glycerol
Other Names Calreticulin 3, CRT2, FLJ25355, MGC26577
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap