Home / Products / proteins / C8G, 21-202 aa, Human, His tag, E.coli

C8G, 21-202 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
C8gamma, also known as C8G, is one of three polypeptides (along with C8 alpha and C8 beta) that constitutes C8, a component of the complement system. C8 participates in the formation of Membrane Attack Complex (MAC).
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01385
Size 100 µg
Host E.coli
Accession
Molecular Weight 22.6 kDa (203aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARGARGAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIFYFPKYGFCEAADQFHVLDEVRR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford)
Formulation Liquid. In 20mM Tris-HCl buffer(pH 8.0) containing 10% glycerol, 2mM DTT, 0.15M NaCl.
Other Names Complement component 8, gamma polypeptide, C8C.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap