Home / Products / proteins / C1QBP,74-282aa, Human, Recombinant, E.coli

C1QBP,74-282aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Human complement component 1, q subcomponent binding protein (C1QBP) is a ubiquitously expressed multifunctional phospho-protein that interacts with the globular heads of C1q (gC1q). This protein also interacts with a wide range of ligands and is implicated in cell signaling. Recombinant C1QBP was expressed in E.coli and purified by conventional chromatography techniques.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01384
Size 100 µg
Host E.coli
Accession
Molecular Weight 23.9kDa (210aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAESDIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQEYITFLEDLKSFVKSQ
Purity > 95% by HPLC
Concentration mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing 1 mM DTT, 20% glycerol
Other Names Complement component 1, q subcomponent binding protein, p33, HABP1, gC1qR, GC1QBP, SF2p32.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap