BTD, 44-545aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
BTD, also known as biotinidase isoform 1, is a member of the nitrilase superfamily, which consists of 12 families of nitrilases, amidases, carbamylases, and N-acyltrasferases. It catalyzes the hydrolysis of biocytin, the product of biotin-dependent carboxylase degradation, to biotin and lysine. It may have an important regulatory role in chromatin/DNA function. Recombinant human BTD, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01373
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 57.8kDa (510aa), 50-70kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences AHTGEESVADHHEAEYYVAAVYEHPSILSLNPLALISRQEALELMNQNLDIYEQQVMTAAQKDVQIIVFPEDGIHGFNFTRTSIYPFLDFMPSPQVVRWNPCLEPHRFNDTEVLQRLSCMAIRGDMFLVANLGTKEPCHSSDPRCPKDGRYQFNTNVVFSNNGTLVDRYRKHNLYFEAAFDVPLKVDLITFDTPFAGRFGIFTCFDILFFDPAIRVLRDYKVKHVVYPTAWMNQLPLLAAIEIQKAFAVAFGINVLAANVHHPVLGMTGSGIHTPLESFWYHDMENPKSHLIIAQVAKNPVGLIGAENATGETDPSHSKFLKILSGDPYCEKDAQEVHCDEATKWNVNAPPTFHSEMMYDNFTLVPVWGKEGYLHVCSNGLCCYLLYERPTLSKELYALGVFDGLHTVHGTYYIQVCALVRCGGLGFDTCGQEITEATGIFEFHLWGNFSTSYIFPLFLTSGMTLEVPDQLGWENDHYFLRKSRLSSGLVTAALYGRLYERDLEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Biotinidase isoform 1, BTD, biotinidase
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap