BPIFA1, 20-256aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BPIFA1, also known as PLUNC, belongs to the short subfamily of PLUNC family proteins and have homology only to the Nterminal domains of BPI. It is a secreted protein that is expressed in the secretory ducts and submucosal glands of tracheobronchial tissues. BPIFA1 binds to lipopolysaccharide (LPS) in nasal lavage fluid (NLF) which points to its role in the inflammatory response of the upper airways after exposure to irritants. Decreased levels of BPIFA1 occur in the NLF of smokers and people who have been exposed to reactive epoxy chemicals, indicating that long-term exposure to airway irritants impairs the production of BPIFA1 in the upper respiratory tract. Recombinant human BPIFA1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01362
Size 100 µg
Host E.coli
Accession
Molecular Weight 27.1 kDa (260aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSQFGGLPVPLDQTLPLNVNPALPLSPTGLAGSLTNALSNGLLSGGLLGILENLPLLDILKPGGGTSGGLLGGLLGKVTSVIPGLNNIIDIKVTDPQLLELGLVQSPDGHRLYVTIPLGIKLQVNTPLVGASLLRLAVKLDITAEILAVRDKQERIHLVLGDCTHSPGSLQISLLDGLGPLPIQGLLDSLTGILNKVLPELVQGNVCPLVNEVLRGLDITLVHDIVNMLIHGLQFVIKV
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 30% glycerol
Other Names BPI fold-containing family A, member 1, bA49G10.5, LPLUNC3, LUNX, NASG, PLUNC, SPURT
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap