BOLA3, 1-107aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BOLA3 also known as BolA-like protein 3 isoform1. BOLA3 is novel non-classical secreted protein and the secretion was not dependent on its predicted signal peptide. Human BolAs belongs to three different groups with functional divergence of BolA subfamily, where the different helix-turn-helix motif among BOLA 1, BOLA 2, and BOLA3 could be responsible for their functional divergence. Recombinant human BOLA3 was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01359
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.5kDa (130aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAAWSPAAAAPLLRGIRGLPLHHRMFATQTEGELRVTQILKEKFPRATAIKVTDISGGCGAMYEIKIESEEFKEKRTVQQHQMVNQALKEEIKEMHGLRIFTSVPKR
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate buffered saline (pH7.4) containing 10% glycerol
Other Names BolA-like protein 3 isoform1 , MMDS2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap