BNP, 27-134aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
BNP (Brain natriuretic peptide) is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. BNP is a 32 amino acid polypeptide and is co-secreted along with a 76 amino acid N-terminal fragment which is biologically inactive. This protein has biological actions including natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01357
Size 100 µg
Host E.coli
Accession
Molecular Weight 14 kDa ( 129 aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMHPLGSPGSASDLETSGLQEQRNHLQGKLSELQVEQTSLEPLQESPRPTGVWKSREVATEGIRGHRKMVLYTLRAPRSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid in phosphate-Buffered Saline (pH 7.4), 20%glycerol
Other Names Brain natriuretic peptide (type B natriuretic peptide), NPPB, GC-B.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap