Home / Products / proteins / BMP- 4, 293-408aa, Human, Recombinant, E.coli

BMP- 4, 293-408aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Bone morphogenetic protein 4 (BMP-4) is a member of the bone morphogenetic protein family which belongs to the TGF-β superfamily. This protein is a vital regulatory molecule that functions throughout bone and cartilage development, specifically tooth development, limb formation, bone induction, and fracture repair. In human embryonic development, BMP- 4 is required for the early differentiation of the embryo and establishing of a dorsalventral axis.
List Price: $278
  • Buy 5 for $264.1 each and save 5%
  • Buy 21 for $250.2 each and save 10%
  • Buy 31 for $236.3 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01348
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.2 kDa (117 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MSPKHHSQRARKKNKNCRRHSLYVDFSDVGWNDWIVAPPGYQAFYCHGDCPFPLADHLNSTNHAIVQTLVNSVNSSIPKACCVPTELSAISMLYLDEYDKVVLKNYQEMVVEGCGCR
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 10mM Sodium citrate buffer (pH 3.5), 10% glycerol
Other Names Bone morphogenetic protein 4, BMP-2B, DVR4.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap