Home / Products / proteins / BMF, 1-129aa, Human, T7-tagged, Recombinant, E.coli

BMF, 1-129aa, Human, T7-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Bcl2 modifying factor, also known as BMF belongs to the Bcl2 protein family of apoptosis mediators. Bmf is constitutively expressed in many tissues. This protein contains a single Bcl2 homology domain 3 (BH3), and has been shown to bind Bcl2 proteins and function as an apoptotic activator.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01347
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.6 kDa (144aa)
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSHMEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYAPAEPKSCVVADPPLPAQPCFEWRREQERGRP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 7.5) containing, 1mM DTT, 10% glycerol
Other Names Bcl2 modifying factor, isoform 3
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap