Home / Products / proteins / Biliverdin reductase A, 3-296 aa, Human, Recombinant, E.coli

Biliverdin reductase A, 3-296 aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
BLVRA, also known as biliverdin reductase A, belongs to the gfo/idh/mocA family. This protein is an enzyme that converts biliverdin to bilirubin, converting a double-bond between the second and third pyrrole ring into a single-bond.( Bilirubin + NAD(P)+ = biliverdin + NAD(P)H ) Recombinant BLVRA protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01337
Size 100 µg
Host E.coli
Accession
Molecular Weight 33.3 kDa (295aa)
AP_Mol_Weight
Tag
Sequences MAEPERKFGVVVVGVGRAGSVRMRDLRNPHPSSAFLNLIGFVSRRELGSIDGVQQISLEDALSSQEVEVAYICSESSSHEDYIRQFLNAGKHVLVEYPMTLSLAAAQELWELAEQKGKVLHEEHVELLMEEFAFLKKEVVGKDLLKGSLLFTAGPLEEERFGFPAFSGISRLTWLVSLFGELSLVSATLEERKEDQYMKMTVCLETEKKSPLSWIEEKGPGLKRNRYLSFHFKSGSLENVPNVGVNKNIFLKDQNIFVQKLLGQFSEKELAAEKKRILHCLGLAEEIQKYCCSRK
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names BLVR, BVR, BVRA.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap